PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10019686m
Common NameEUTSA_v10019686mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family MIKC_MADS
Protein Properties Length: 328aa    MW: 37486.8 Da    PI: 4.6142
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10019686mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF82.33.1e-26958150
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                     krien++nrqvtfskRrng++KKA+ELS+LCd+++a+++fs++++l  +s
  Thhalv10019686m  9 KRIENNTNRQVTFSKRRNGLIKKAYELSILCDIDIALLMFSPSDRLSLFS 58
                     79******************************************998776 PP

2K-box27.31.5e-10121200988
            K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelq 88 
                      + +++ e+l+qe+ kL++++++ ++e+R++  + +   +++e +  e+qL + l+++ ++++++l +qi+       ++q
  Thhalv10019686m 121 AINSDVEELEQEVYKLQQQLHMAEEELRKYEPDPIRFTTMEEYETCEKQLMDTLTRVTQRREHILSDQISSFEASAIQQQ 200
                      5577899**************************************************************98876665555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006628.819161IPR002100Transcription factor, MADS-box
SMARTSM004322.1E-35160IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.32E-29285IPR002100Transcription factor, MADS-box
CDDcd002653.44E-34275No hitNo description
PRINTSPR004042.0E-24323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003193.6E-241055IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-242338IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-243859IPR002100Transcription factor, MADS-box
PfamPF014869.2E-7125194IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MGRVKLEIKR IENNTNRQVT FSKRRNGLIK KAYELSILCD IDIALLMFSP SDRLSLFSGK  60
TRIEDVFTRY INLPDQEREN ALSNPDQSRR PDFQSKEYLL RTLQQLKTEN DIALQLTNPA  120
AINSDVEELE QEVYKLQQQL HMAEEELRKY EPDPIRFTTM EEYETCEKQL MDTLTRVTQR  180
REHILSDQIS SFEASAIQQQ NLGGPYVNVG GWLAENGPNQ AHMFDSSAHS AMYETLLQGS  240
SSSSNQNNTM GECHMTNPNG DMYQEWAQAY TSPTGLNPTP MFPPMQHQHG VVGPNMEESE  300
IPVMTREAQA DHEVSDYDIR MPQLSSQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P1e-16181182Myocyte-specific enhancer factor 2B
1tqe_Q1e-16181182Myocyte-specific enhancer factor 2B
1tqe_R1e-16181182Myocyte-specific enhancer factor 2B
1tqe_S1e-16181182Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ4464410.0DQ446441.1 Arabidopsis thaliana clone pENTR221-At1g77980 MADS-box family protein (At1g77980) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006390037.10.0hypothetical protein EUTSA_v10019686mg
SwissprotQ1PFC20.0AGL66_ARATH; Agamous-like MADS-box protein AGL66
TrEMBLV4KJ820.0V4KJ82_EUTSA; Uncharacterized protein
STRINGfgenesh2_kg.2__2091__AT1G77980.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21792365
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77980.10.0AGAMOUS-like 66